Protein Labeling Reagents
Chem-Impex International, Inc. Fluorescein isothiocyanate isomer I | 3326-32-7 | MFCD00005063 | 250MG
Fluorescein isothiocyanate isomer I, 3326-32-7, MFCD00005063, 250MG
CPC Scientific TAMRA-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH (trifluoroacetate salt) 0.5MG
beta-Amyloid (1-40) found to exhibit both neurotrophic and neurotoxic effects that depend on neuronal age and beta-protein concentration.ONE-LETTER SEQUENCE: TAMRA-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVMOLECULAR FORMULA: C219H315N55O62S1MOLECULAR WEIGHT:4742.4STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [1802087-81-5], SYNONYMS: 5-TAMRA-Amyloid β-Protein (1-40)RESEARCH AREA: Alzheimer's DiseaseREFERENCES: B.A. Yankner et al., Science, 250, 279 (1990)
Revvity Health Sciences Inc IVISense Featured Probes Pack Fluorescent Imaging Panel
IVISense Featured Probes Pack Fluorescent Imaging Panel
Medchemexpress LLC HY-D0818 5mg Medchemexpress, CY3-YNE CAS:1010386-62-5 Purity:>98%
Medchemexpress, HY-D0818 5mg CY3-YNE CAS:1010386-62-5 Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.
Medchemexpress LLC Cy5-PEG3-azide | 00-00-0 | MFCD28142475 | 99.5% | 719.36 | C40H55ClN6O4 | 5 MG
Cy5-PEG3-azide is a PEG-based linker dye bearing an azide group for bioorthogonal conjugation. It is designed for use in click chemistry and linker-dependent constructs, enabling efficient attachment to alkyne-bearing partners for bioconjugation and PROTAC synthesis.
- PEG-based linker with azide functionality for click chemistry.
- Compatible with copper-catalyzed and strain-promoted azide-alkyne cycloaddition.
- Suitable for PROTAC synthesis and general bioconjugation workflows.
- High purity for reliable analytical and preparative results.
- Store at -20°C and protect from light; in solution, store at -80°C for long-term.
Medchemexpress LLC HY-50938 50mg Medchemexpress, D149 Dye CAS:786643-20-7 Purity:>98%
Medchemexpress, HY-50938 50mg D149 Dye CAS:786643-20-7 D149 Dye is an indoline-based dye, which is a high-extinction-coefficient metal-free organic sensitizer. Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.
CPC Scientific FAM-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-OH (trifluoroacetate salt) 0.5MG
Pituitary hormone N-terminal synthetic fragment that stimulates the corticosteroid synthesis and secretion in the adrenal cortex. This peptide is more active than ACTH in terms of corticosteroid releasing activity in vitro.ONE-LETTER SEQUENCE: Fam-SYSMEHFRWGKPVGKKRRPVKVYPMOLECULAR FORMULA: C157H220N40O37S1MOLECULAR WEIGHT:3291.8STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [16960-16-0], RESEARCH AREA: HormonalREFERENCES: Y.F.Jacquet, Science, 201, 1032 (1978)
STA Pharmaceutical Fmoc-L-Lys(5-FAM)-OH | 25 g | CAS 1242933-88-5 | MDL MFCD03787910
Fmoc-L-Lys(5-FAM)-OH is a Amino Acid reagent (Subcategory: Lys) sold by WuXi TIDES. Offered in 25 g. Store at 4 °C. SDS available for reference.
Specifications
- CAS: 1242933-88-5
- MDL: MFCD03787910
- InChIKey: ZAGGWQSWIFPNCB-DHUJRADRSA-N
- Molecular Weight: 726.738
- Molecular Formula: C42H34N2O10
- Purity: ≥95%
- Container Type: 125 mL HDPE
- Pack Size: 25 g
- Net Weight: 25 g
- Gross Weight: 54.3 g
- Commodity Code: 29322090
- Country Of Origin: China
- IUPAC: N2-(((9H-fluoren-9-yl)methoxy)carbonyl)-N6-(3',6'-dihydroxy-3-oxo-3H-spiro[isobenzofuran-1,9'-xanthene]-5-carbonyl)-L-lysine
- SMILES: O=C(OCC1C2=C(C3=C1C=CC=C3)C=CC=C2)N[C@@H](CCCCNC(C4=CC5=C(C=C4)C6(C7=C(OC8=C6C=CC(O)=C8)C=C(O)C=C7)OC5=O)=O)C(O)=O
Medchemexpress LLC Cyanine2 succinimidyl ester (iodine) | 186205-33-4 | 98.1% | 643.47 g/mol | C29H30IN3O6 | 10 MG
Cy2-SE (iodine) is an iodinated Cyanine2 succinimidyl ester fluorescent labeling reagent used for amine-reactive conjugation to proteins, antibodies, and small molecules. It provides strong absorption and emission characteristics typical of cyanine dyes, with high extinction coefficient and good water solubility.
- Amine-reactive succinimidyl ester for stable protein conjugation.
- Suitable for labeling antibodies and small biomolecules.
- High purity (98.11%) for consistent conjugation performance.
- Molecular weight 643.47 g/mol; chemical formula C29H30IN3O6.
- Analytical support available: data sheet, COA, SDS, and spectral data.
Lumiprobe Sulfo-Cyanine7.5 NHS ester, 1 mg
Sulfo-Cyanine7.5 is a near infrared water soluble and hydrophilic dye for the NIR imaging applications.
Immunochemistry Technology FAM FLICA CASPASE 1 ASSAY KIT
FAM-FLICA™ Caspase-1 Assay Kit, 25 Tests Detect caspase-1 activity with the FAM FLICA™ Caspase-1 Assay Kit. This in vitro assay employs the fluorescent inhibitor probe FAM-YVAD-FMK to label active caspase-1 enzyme in living cells or tissue samples. Analyze the green fluorescent signal using fluorescence microscopy, a fluorescent plate reader, or by flow cytometry. Caspases play important roles in apoptosis and inflammation. ICT's FLICA assay kits are used by researchers seeking to quantitate apoptosis via caspase activity in cultured cells and tissues. The FAM FLICA Caspase 1 probe allows researchers to assess caspase-1 activation.